Anti-LSECtin/CLEC4G Rabbit Polyclonal Antibody

Supplier: Novus Biologicals
NBP1-82815
NOVUNBP1-82815EA 652 EUR
NOVUNBP1-82815
Anti-LSECtin/CLEC4G Rabbit Polyclonal Antibody
Antibodies
The LSECtin / CLEC4G Antibody from Novus Biologicals is a rabbit polyclonal antibody to LSECtin / CLEC4G. This antibody reacts with human. The LSECtin / CLEC4G Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.

Type: Primary
Antigen: LSECtin/CLEC4G
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human
Order Now

SPECIFICATIONS

Antigen symbol LSECtin/CLEC4G
Environmentally Preferable
Antigen synonyms liver and lymph node sinusoidal endothelial cell C-type lectin|LSECtin|DTTR431|member G|C-type lectin domain family 4|UNQ431|LP2698|C-type lectin superfamily 4|C-type lectin domain family 4 member G
Antibody type Primary
Clonality Polyclonal
Conjugation Unconjugated
Reactivity Human
Host Rabbit
Gene ID 339390
Isotype IgG
ImmunoChemistry Yes
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKR
Purification Immunogen affinity purified
Storage buffer PBS (pH 7,2) and 40% Glycerol
Storage temperature Store at 4 °C short term. Aliquot and store at -20 °C long term. Avoid freeze-thaw cycles.

Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR