You Searched For: Columbia+Biosciences


21 058  results were found

SearchResultCount:"21058"

Sort Results

List View Easy View (new)

Rate These Search Results

Catalog Number: (COBSD9-1718)
Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (DyLight® 550) [clone: M2]
UOM: 1 * 100 µG


Supplier: Columbia Biosciences
Description: Anti-6X His tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: AD1.1.10]

Catalog Number: (COBSB1-1711)
Supplier: Columbia Biosciences
Description: Anti-6X His tag Mouse Monoclonal Antibody (Biotin) [clone: AD1.1.10]
UOM: 1 * 100 µG


Catalog Number: (COBSD3-1866-50)
Supplier: Columbia Biosciences
Description: Anti-EP4 receptor C-terminal amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) Rabbit Polyclonal Antibody (APC (Allophycocyanin))
UOM: 1 * 50 µG


Catalog Number: (COBSD3-1714-100)
Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: 9E10]
UOM: 1 * 100 µG


Catalog Number: (COBSD5-1762)
Supplier: Columbia Biosciences
Description: Anti-Acetyl Lysine Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 7F8]
UOM: 1 * 100 µG


Catalog Number: (COBSD11-1714)
Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: 9E10]
UOM: 1 * 100 µG


Catalog Number: (COBSD7-1714)
Supplier: Columbia Biosciences
Description: Anti-c-Myc tag Mouse Monoclonal Antibody SureLight® P3 [clone: 9E10]
UOM: 1 * 100 µG


Catalog Number: (COBSD5-1866-50)
Supplier: Columbia Biosciences
Description: Anti-EP4 receptor C-terminal Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 50 µG


Catalog Number: (COBSD5-1718)
Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: M2]
UOM: 1 * 100 µG


Catalog Number: (COBSD11-1718)
Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (Peridinin Chlorophyll) [clone: M2]
UOM: 1 * 100 µG


Catalog Number: (COBSD5-1722)
Supplier: Columbia Biosciences
Description: Anti-HA tag Mouse Monoclonal Antibody (RPE (R-Phycoerythrin)) [clone: 16B12]
UOM: 1 * 100 µG


Catalog Number: (COBSD10-1718-100)
Supplier: Columbia Biosciences
Description: Anti-DYKDDDDK Tag Mouse Monoclonal Antibody (DyLight® 650) [clone: M2]
UOM: 1 * 100 µG


Catalog Number: (COBSD5-1864)
Supplier: Columbia Biosciences
Description: Anti-NAD+-dependent 15-hydroxy PGDH Rabbit Polyclonal Antibody (RPE (R-Phycoerythrin))
UOM: 1 * 100 µG


Catalog Number: (COBSHRP-1711)
Supplier: Columbia Biosciences
Description: Anti-6X His tag Mouse Monoclonal Antibody HRP (Horseradish Peroxidase) [clone: AD1.1.10]
UOM: 1 * 100 µG


Catalog Number: (COBSD3-1760)
Supplier: Columbia Biosciences
Description: Anti-cytokeratins 4, 5, 6, 8, 10, 13, and 18 Mouse Monoclonal Antibody (APC (Allophycocyanin)) [clone: C11]
UOM: 1 * 100 µG


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at +43 1 97002 - 0.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at +43 1 97002 - 0.
Dual use goods can only be delivered within the European Union.
Dual use goods can only be delivered within the European Union.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at +43 1 97002 - 0.
305 - 320 of 21 058
no targeter for Bottom